Annotate tandem repeats from sequence domain models.¶
Here you learn how to annotate sequences with your favourite sequence profile model. The sequence profile model is transformed into a circular profile HMM, as described in a recent MBE publication. Next, the sequence is searched for tandem repeats using the circular profile HMM.
Requirements for this tutorial:
Install TRAL. TRAL ships with the data needed for this tutorial.
Install Mafft/ginsi for tandem repeat unit alignment.
Install Castor. If you wish to realign your repeat MSA you need to have proPIP installed beforehand.
Todo
write section to install castor with aligner proPIP
Read in your sequence profile model.¶
import os
from tral.hmm import hmm
from tral.paths import PACKAGE_DIRECTORY
pfam_profile_HMM = os.path.join(PACKAGE_DIRECTORY,"examples", "data","Kelch_1.hmm")
circular_profile_HMM_Kelch_1 = hmm.HMM.create(input_format = 'hmmer', file = pfam_profile_HMM)
See the basic characteristics of the circular profile HMM:
>>> print(circular_profile_HMM_Kelch_1)
cpHMM ID: PF01344.20
cpHMM length: 47
Most likely motif: ARSSAGVVVLDGKIYVIGGRDGDGNALNSVERYDPVTNTWEKLPSMP
Read in your sequences.¶
from tral.sequence import sequence
human_HCFC1_fasta = os.path.join(PACKAGE_DIRECTORY,"examples", "data", "P51610.fasta")
human_HCFC1_sequence = sequence.Sequence.create(file = human_HCFC1_fasta, input_format = 'fasta')[0]
Annotate tandem repeats with the circular profile HMM.¶
tandem_repeats = human_HCFC1_sequence.detect(lHMM = [circular_profile_HMM_Kelch_1])
The result is a tandem repeat (interpretation):
>>> print(tandem_repeats.repeats[0])
> begin:31 l_effective:53 n:5
R--------PRHGHRAVAIKELIVVFGGGN----------EGIVD-----------------------------------------------------------ELHVYNTATNQWFI---PAVRGDIP-
P--------GCAAYGFVCDGTRLLVFGGMV-----------------------------------EYG-------------------KYSN-------------DLYELQASRWEWKR-----LKAK---
TPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNK---PSLSGVAPL
---------PRSLHSATTIGNKMYVFGGWV----------PLVMDDV-------------------------------KVATHEKEWKCTN-------------TLACLNLDTMAWETILMDTLEDNIP-
R--------ARAGHCAVAINTRLYI---------------------------------------------------------------------------------------------------------
Annotate tandem repeats with the circular profile HMM and realign with proPIP.¶
Alternatively, you can directly include tandem repeat MSA realignment with the indel-aware proPIP algorithm:
tandem_repeats = human_HCFC1_sequence.detect(lHMM = [circular_profile_HMM_Kelch_1], realignment='proPIP')
>>> print(tandem_repeats.repeats[0])
> begin:31 l_effective:48 n:5
-RP-R-----------HGHRA-V---A--------I-----K--------ELIVVF----G-G----------GN-----E-G---I--V--D--ELH-V-YN-T-A-T--N--Q--W---F---IPAV---R-GD---I-P-
--PGC-----A---A-YGF---V---C--D-G---T-----R---------LL-VF----G-G-------M---V-----EYG--KY--S--N--DL----YELQ-A-S-----R--WE--W-KRLKA----K----------
T-P-KNGPPPCPR-LGHSF-SLVGNKCYL-FGGLANDSEDPKNNIPRYLNDLY-ILELRPGSGVVAWDIPITYGVLPPPRE-SHTAVVYTEKDNKKSKLVIYG-GMSGCRLG-D-L-W-T-LD--IDTLTWNKP-SLSGVAPL
--P-R-----S---L-HS--A-T---T-I--G---N-----K---------MY-VF----G-G---W-VPL---VM----D-D-VKVA-T-HE-KEWK-C-TN-TLA-C-LNLDTMAWETIL---MDTL---E--D-N-I-P-
----R-----A--RA--GH-------C--------A------------------V-------A-----------I-----------------N---------------T-----R--L---Y---I-----------------
If you wish to use a gamma distribution for indels, choose the option rate_distribution = ‘gamma’ or modify the rate distribution in config.ini.
Output the detected tandem repeats.¶
Write a singe repeat_list to .tsv format:
path_to_output_tsv_file = "outputfile.tsv" # Choose your path and filename
tandem_repeats.write(output_format = "tsv", file = path_to_output_tsv_file)
This is how the output looks like (interpretation):
$ cat outputfile.tsv
begin msa_original l_effective n_effective repeat_region_length divergence pvalue
31 R--------PRHGHRAVAIKELIVVFGGGN----------EGIVD-----------------------------------------------------------ELHVYNTATNQWFI---PAVRGDIP-,P--------GCAAYGFVCDGTRLLVFGGMV-----------------------------------EYG-------------------KYSN-------------DLYELQASRWEWKR-----LKAK---,TPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNK---PSLSGVAPL,---------PRSLHSATTIGNKMYVFGGWV----------PLVMDDV-------------------------------KVATHEKEWKCTN-------------TLACLNLDTMAWETILMDTLEDNIP-,R--------ARAGHCAVAINTRLYI--------------------------------------------------------------------------------------------------------- 53 4.056603773584905 306 None None
Write a singe repeat_list to .pickle format:
path_to_output_pickle_file = "outputfile.pickle" # Choose your path and filename
tandem_repeats.write(output_format = "pickle", file = path_to_output_pickle_file)
A repeat_list in pickle format can easily be read in again:
from tral.repeat_list import repeat_list
tandem_repeats = repeat_list.RepeatList.create(input_format = "pickle", file = path_to_output_pickle_file)
